Glucagon

CAS: 16941-32-5

Product Name: Glucagon
Synonyms: GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl
MF: C153H225N43O49S
MW: 3482.75
EINECS: 685-611-6
Product Categories: Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research;16941-32-5
Mol File: 16941-32-5.mol

Glucagon Price(USD/Box):$70/2mg $105/5mg $185/10mg                2mg,5mg,10mg/1vial 10vials/1box
Category:
Glucagon peptide benefits

Glucagon is your best friend. It is the hormone that is released when your body decides its time to draw on your stored body fat. It works in a kind of polaropposite fashion to the hormone insulin which is released when we have too much sugar and it tells our body to store it. Quite simply, if you eat foods that break down to sugar easily you stimulate insulin and start the fat storage process, whereas when you need energy and there is not decreased sugar in the blood your body will release glucagon to mobilise your fat stores.

The main role of glucogon is to promote the decomposition of glycogen and the production of glucose to elevate blood sugar; secondly, it also can promote lipolysis by leaving cyclic AMP (cAMP) levels increased via adenylate cyclase, thereby activating protein kinase and tissue lipase; in addition, through the activation of cardiac adenylate cyclase system, and promoting myocardial phosphorylase activity, it can increase the accumulation of calcium in the myocardium, thereby enhance myocardial contractility, increase cardiac output and blood pressure; It can promote insulin, somatostatin, thyroxine and calcitonin secretion; moreover, promote sympathetic and pheochromocyte catecholamines release.

Physiological

Glucagon pronunciation is a single chain polypeptide hormone synthesized and secreted by islet α2 cells and it is a physiological antagonist of insulin. The impact on metabolism is similar to epinephrine. It has the following effects:
1. Blood glucose elevating effects: it can activate the phosphorylase in the liver, promote hepatic glycogen decomposition and gluconeogenesis, thus increasing blood sugar.
2. Positive inotropic action: it can increase intracellular cAMP levels, enhance myocardial contractility, increase cardiac output and stroke volume. Its positive inotropic effect can still manifest when applied with sufficient cardiac glycoside, and it will not be blocked by propranolol. Although it can increase heart rate and blood pressure, but will not cause arrhythmia. The mechanism is as follows: ①the activation of adenylate cyclase turned adenosine triphosphate into cyclization of adenosine monophosphate, making the myocardial contractility increased;
② promoting liver glycogen breakdown and increasing blood glucose levels;
③ promoting insulin release, improving the use of myocardial glucose and promoting myocardial anaerobic glycolysis, thereby improving myocardial energy metabolism. When combined with digitalis cardiac glycosides, It can increase the efficacy.
3. The role on the kidney: expanding renal blood vessels, improving renal blood flow, and promoting the excretion of sodium, potassium and calcium.
4. The role on the digestive system: it can cause the smooth muscle relaxation of stomach and duodenum, small intestine and colon and inhibit stomach, small intestine and colon peristalsis, increase the secretion of bile and intestinal fluid.
5. The role on the secretion system: exciting adrenal medulla, promoting the release of catecholamines. It can also promote insulin, thyroid hormone, calcitonin and growth hormone secretion.glucagon like peptide

Glucagon peptide dosage

Usage and dosage 3~5mg for the first administration; intravenous injection of glucose solution. If there are no adverse reactions after 2~5min , intravenous infusion rate of 2.5~10mg/h is available. It will work after 1~3min of intravenous injection, 10min arrives at the peak, 30min effect disappears. It can be applied 24h continuously depending on the medical necessity.
Intramuscular, subcutaneous or intravenous: hypoglycemic coma, 0.5~1mg, if necessary, re-administration every 20 minutes. 5 to 20 minutes can be effective. If after 1 hour is still invalid, use of glucose as soon as possible. The dose for children is 5μg/kg.
Vein dropping: diluted infusion of 5% glucose injection. Congestive heart failure, 2.5~7.5mg per hour. Cardiogenic shock; 1~12mg per hour as the medical necessity; sustainable 24 hours intravenous infusion.

Glucagon peptide Chemical Properties
density 1.53±0.1 g/cm3(Predicted)
storage temp. Keep in dark place,Sealed in dry,2-8°C
solubility Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
form powder
Water Solubility Soluble to 1 mg/ml in water
InChIKey MASNOZXLGMXCHN-SXVMFYJYNA-N

More Introduction:https://en.wikipedia.org/wiki/Glucagon

Price(USD/Box)

$70/2mg $105/5mg $185/10mg               
2mg,5mg,10mg/1vial 10vials/1box