CJC-1295 With DAC CJC-1295 Without DAC

CAS: 863288-34-0

Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
MF: C152H252N44O42
MW: 3367.89688
EINECS: 206-141-6
Product Categories: Peptides;CJC;863288-34-0
Mol File: 863288-34-0.mol

Price(USD/Box):CJC-1295 With DAC  $80/2mg $140/5mg $240/10mg  CJC-1295 With out DAC  $40/2mg $75/5mg $110/10mg      2mg,5mg,10mg/1bottle 10bottle/1box

CJC-1295, also known as DAC:GRF (short for drug affinity complex:growth hormone-releasing factor), is a synthetic analogue of growth hormone-releasing hormone (GHRH) (also known as growth hormone-releasing factor (GRF)) and a growth hormone secretagogue (GHS) which was developed by ConjuChem Biotechnologies. It is a modified form of GHRH (1-29) with improved pharmacokinetics, especially in regard to half-life.

Effects
CJC-1295 markedly increases plasma growth hormone (GH) and insulin-like growth factor 1 (IGF-1) levels in both animals and humans. With a single injection, in human subjects, buy CJC-1295 increases plasma GH levels by 2- to 10-fold for 6 days or longer and plasma IGF-1 levels by 0.5- to 3-fold for 9 to 11 days. The drug has an estimated half-life of about 6 to 8 days in humans. With multiple doses of CJC-1295, IGF-1 levels were found to remain elevated in humans for up to 28 days.

It has been shown to extend the half-life and bioavailability of growth-hormone-releasing hormone 1-29 and stimulate insulin-like growth factor 1 secretion. It increases the half-life of acting agents by bioconjugation.

Risks
It was under investigation for the treatment of lipodystrophy and growth hormone deficiency and reached phase II clinical trials. But was discontinued upon the death of one of the trial subjects. The attending physician of the trial believed that the most likely explanation for the incident was that the patient had asymptomatic coronary artery disease with plaque rupture and occlusion, and that the occurrence was unrelated to treatment with CJC-1295 peptide. Research was terminated nonetheless as a precaution.

CJC1295 peptide Chemical Properties
Melting point > 177° C (dec.)
density 1.45
storage temp. -20°C Freezer, Under inert atmosphere
solubility Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
form Solid
color White to Off-White
InChIKey XOZMWINMZMMOBR-HRDSVTNWSA-N

More Introduction:https://en.wikipedia.org/wiki/CJC-1295

Price(USD/Box)

CJC-1295 With DAC  $80/2mg $140/5mg $240/10mg 
CJC-1295 With out DAC  $40/2mg $75/5mg $110/10mg     
2mg,5mg,10mg/1bottle 10bottle/1box