,

CJC-1295 With DAC CJC-1295 Without DAC

CAS: 863288-34-0

Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
MF: C152H252N44O42
MW: 3367.89688
EINECS: 206-141-6
Product Categories: Peptides;CJC;863288-34-0
Mol File: 863288-34-0.mol

Price(USD/Box):CJC-1295 With DAC  $55/2mg $140/5mg $110/10mg  CJC-1295 Without DAC   $50/5mg $80/10mg      5mg,10mg/1vial 10vials/1box
Categories: ,

‌CJC-1295 is a long-acting growth hormone-releasing hormone analog that can significantly increase the levels of endogenous growth hormone and IGF-1. ‌ CJC-1295 is composed of 30 amino acids and is a synthetic GHRH (growth hormone-releasing hormone) analog with long-acting and high efficacy. It promotes muscle growth and fat loss by stimulating the pituitary gland to secrete growth hormone‌.

CJC-1295 Benefits

CJC-1295 increases growth hormone production and IGF-1 levels without increasing prolactin
Increases weight and length by increasing protein synthesis
And muscle growth
Increases fat loss
Increases cell repair and regeneration
Promotes deep slow-wave sleep, which is responsible for memory retention and rejuvenation
CJC 1295 also helps with wound recovery time, body fat loss, immune system and bone density, and cellular repair (skin and organs).

CJC1295 VS CJC1295 without DAC

There are two versions of CJC, the CJC1295 without DAC can also be called.
CJC1295 without the DAC can also be called: Mod GRF 1-29, in most cases I recommend using CJC-223 with the DAC 1295.
The two products have different durations of action; Mod GRF (CJC-1295 without DAC) has a near ideal short duration of action allowing for pulsatile administration, whereas CJC-1295 with DAC has a prolonged duration of action, and the peptide produces an increase in growth hormone secretion similar to that produced by the peptide but without the effects on appetite stimulation and cortisol, as well as acetylcholine, prolactin, and aldosterone. and aldosterone.

Due to the extremely short half-life of the original GRF 1-29, chemists have modified the peptide to provide a longer period of bioactivity, thereby reducing metabolic clearance. metabolic clearance. Despite the use of MOD GRF 1-29, whose modifications have resulted in larger peptide bonds, users still require two to three daily injections of GHRP for maximum effect. The addition of the Drug Affinity Complex (DAC) to CJC 1295 extends its half-life to 8 days while providing smaller GH pulses. the longer half-life of the DAC-bound albumin means that only one or two injections per week are required. However, the long half-life and relatively constant blood levels provide a constant stimulus for the release of GH from the pituitary via GHRH receptors, which are not physiologic. This reduces the amplitude of the GH pulse, which results in reduced GH tissue stimulation.

CJC-1295 side effects

Pain from nerve compression (e.g., wrist pain), injection site reactions (irritation, erythema, hardness, pain, itching), headache, diarrhea, vasodilation (flushing, fever, transient hypotension), nausea, abdominal pain, body fluid retention, tingling, numbness, insulin decreases, fatigue, lethargy, panic, or euphoria.

cjc 1295 dosag

As mentioned earlier, to mimic the natural release of growth hormone, CJC 1295 without DAC should be injected 1-3 times per day at a dose of 100mcg-200mcg. In my opinion, a better way to use CJC 1295 would be to use CJC 1295 with DAC, which would allow the athlete to have just two injections per week, usually at a dose of 2mg twice per week, in addition to daily GHRP injections, which would provide smaller but more frequent pulses of growth hormone.

With long-acting CJC1295, a three-month “hormone vacation” should be taken every three to six months to allow the pituitary gland to “recover”, which is considered the safest method of administration. Sermorelin is used instead of CJC 1295 + DAC during the holiday. The “hormone holiday” also minimizes the risk of developing GH resistance. This resistance or insensitivity can occur through the formation of antibodies that bind and inactivate GH, or through a decrease in the number of GH receptors in the tissues (downregulation).
For weight loss, fitness, and repair of damage: multiple doses, along with exercise and proper diet.

Diet. This will reduce fat levels and increase muscle mass.

With multiple doses throughout the day, each injection should be spaced at least 3 hours apart. Ideally, these peptides should be given on an empty stomach or only with protein-containing foods, as carbohydrates or fats can inhibit the release of growth hormone if they are present in the stomach.
Eating should be started at least 15 minutes and up to 30 minutes after the peptides have been administered. This is because growth hormone release will be at its peak by this time.
Peptides, like steroids, should be used in multiples to achieve a synergistic effect. Therefore, Mod GRF 1-29 should ideally be used with peptides such as Ipamorelin or GHRP-6.

CJC1295 peptide Chemical Properties
Melting point > 177° C (dec.)
density 1.45
storage temp. -20°C Freezer, Under inert atmosphere
solubility Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
form Solid
color White to Off-White
InChIKey XOZMWINMZMMOBR-HRDSVTNWSA-N

More Introduction:https://en.wikipedia.org/wiki/CJC-1295

Price(USD/Box)

CJC-1295 With DAC  $80/2mg $140/5mg $240/10mg 
CJC-1295 With out DAC  $40/2mg $75/5mg $110/10mg     
2mg,5mg,10mg/1vial 10vials/1box